A Alpha-Actin-1 (ACTA1) Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A2319
Zusätzliche Namen:: ACTA|ASMA|CFTD|CFTD1|CFTDM|CMYP2A|CMYP2B|CMYP2C|MPFD|NEM1|NEM2|NEM3|SHPM|A Alpha-Actin-1 (ACTA1)
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 42kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAP
Uniprot:: P68133
Synonyme:: ACTA;actin, alpha skeletal muscle;Alpha-actin-1;ASMA;CFTD;CFTD1;CFTDM;MPFD;NEM1;NEM2;NEM3;nemaline myopathy type 3;SHPM
Weitere Details:: The product encoded by this gene belongs to the actin family of proteins, which are highly conserved proteins that play a role in cell motility, structure and integrity. Alpha, beta and gamma actin isoforms have been identified, with alpha actins being a major constituent of the contractile apparatus, while beta and gamma actins are involved in the regulation of cell motility. This actin is an alpha actin that is found in skeletal muscle. Mutations in this gene cause a variety of myopathies, including nemaline myopathy, congenital myopathy with excess of thin myofilaments, congenital myopathy with cores, and congenital myopathy with fiber-type disproportion, diseases that lead to muscle fiber defects with manifestations such as hypotonia.

Versandbedingungen:: Blue Ice