A23163
VEGFC Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A23163
- Zusätzliche Namen:
- Flt4-L|LMPH1D|LMPHM4|VEGFC|VRP
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 47kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
- Uniprot:
- P49767
- Synonyme:
- Flt4 ligand;FLT4 ligand DHM;Flt4-L;LMPH1D;LMPHM4;vascular endothelial growth factor C;vascular endothelial growth factor-related protein;VRP
- Weitere Details:
- The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. The encoded protein promotes angiogenesis and endothelial cell growth, and can also affect the permeability of blood vessels. The proprotein is further cleaved into a fully processed form that can bind and activate VEGFR-2 and VEGFR-3 receptors.
- Versandbedingungen:
- Blue Ice