GRASP65 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A2316
Zusätzliche Namen:: GOLPH5|GRASP65|P65
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 60-70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SGPEDICSSSSSHERGGEATWSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEGLDTGTEAEGLDSQAQISTTE
Uniprot:: Q9BQQ3
Synonyme:: Golgi peripheral membrane protein p65;Golgi phosphoprotein 5;Golgi reassembly and stacking protein 1;golgi reassembly stacking protein 1, 65kDa;Golgi reassembly-stacking protein 1;golgi reassembly-stacking protein of 65 kDa;GOLPH5;GRASP65;P65
Weitere Details:: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a caspase-3 substrate, and cleavage of this encoded protein contributes to Golgi fragmentation in apoptosis. This encoded protein can form a complex with the Golgi matrix protein GOLGA2, and this complex binds to the vesicle docking protein p115. Alternative splicing results in multiple transcript variants of this gene.