A23154
Cleaved Caspase-7 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A23154
- Zusätzliche Namen:
- CASP-7|Cleaved Caspase-7|CMH-1|ICE-LAP3|LICE2|MCH3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 20kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- CFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSG
- Uniprot:
- P55210
- Synonyme:
- apoptotic protease MCH-3;CASP-7;caspase 7, apoptosis-related cysteine peptidase;caspase 7, apoptosis-related cysteine protease;caspase-7;CMH-1;ICE-LAP3;ICE-like apoptotic protease 3;LICE2;MCH3
- Weitere Details:
- This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The precursor of the encoded protein is cleaved by caspase 3 and 10, is activated upon cell death stimuli and induces apoptosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Versandbedingungen:
- Blue Ice