ATP6 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23150
Zusätzliche Namen:: ATP6
Anwendung:: ELISA, WB
Molekulargewicht:: 20kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AHFLPQGTPISLIPMLIIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLVLMNISPPTATITFIILLLLTILEFAVALIQAYVFTLLVSLYLHDNT
Uniprot:: P00848
Synonyme:: ATP synthase F0 subunit 6;ATPase6;F-ATPase protein 6;MTATP6
Weitere Details:: Predicted to contribute to proton-transporting ATP synthase activity, rotational mechanism. Predicted to be involved in mitochondrial ATP synthesis coupled proton transport. Located in mitochondrion. Is expressed in several structures, including alimentary system; brain; heart; integumental system; and sensory organ. Human ortholog(s) of this gene implicated in Leber hereditary optic neuropathy; NARP syndrome; Parkinson's disease; multiple sclerosis; and systemic lupus erythematosus. Orthologous to human MT-ATP6 (mitochondrially encoded ATP synthase membrane subunit 6).