A2315
Nogo Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A2315
- Zusätzliche Namen:
- ASY|Nbla00271|Nbla10545|NI220/250|NOGO|NSP|NSP-CL|RTN-X|RTN4-A|RTN4-B1|RTN4-B2|RTN4-C
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 45kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPRGPLPAAPPVAPERQPSWDPSPVSSTVPAPSPLSAAAVSPSKLPEDDEPPARPPPPPPASVSPQAEPVWT
- Uniprot:
- Q9NQC3
- Synonyme:
- ASY;foocen;Human NogoA;My043 protein;Nbla00271;Nbla10545;neurite growth inhibitor 220;neurite outgrowth inhibitor;Neuroendocrine-specific protein;neuroendocrine-specific protein C homolog;NI220/250;NOGO;NSP;NSP-CL;reticulon 5;reticulon-4;Reticulon-5;RTN-X;RTN4-A;RTN4-B1;RTN4-B2;RTN4-C
- Weitere Details:
- This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified.
- Versandbedingungen:
- Blue Ice