A23148
PLA2R1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A23148
- Zusätzliche Namen:
- CLEC13C|PLA2-R|PLA2G1R|PLA2IR|PLA2R|PLA2R1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 180 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- YQYDVPWLFYQDAEYLFHTFASEWLNFEFVCSWLHSDLLTIHSAHEQEFIHSKIKALSKYGASWWIGLQEERANDEFRWRDGTPVIYQNWDTGRERTVNNQ
- Uniprot:
- Q13018
- Synonyme:
- 180 kDa secretory phospholipase A2 receptor;C-type lectin domain family 13 member C;CLEC13C;M-type receptor;phospholipase A2 receptor 1, 180kD;phospholipase A2 receptor 1, 180kDa;PLA2-R;PLA2G1R;PLA2IR;PLA2R;secretory phospholipase A2 receptor
- Weitere Details:
- This gene represents a phospholipase A2 receptor. The encoded protein likely exists as both a transmembrane form and a soluble form. The transmembrane receptor may play a role in clearance of phospholipase A2, thereby inhibiting its action. Polymorphisms at this locus have been associated with susceptibility to idiopathic membranous nephropathy. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Versandbedingungen:
- Blue Ice