COX1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23123
Zusätzliche Namen:: COX1|CoxI
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 37 kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTTWNTVSSMGSFISLTAVLIMIFMIWEAFASKREVMSVSYASTNLEWLHGCPPPYHTFEEPTYVKVK
Uniprot:: P00397
Synonyme:: CoxI;Cytochrome c oxidase polypeptide I
Weitere Details:: Enables cytochrome-c oxidase activity. Predicted to be involved in electron transport coupled proton transport; mitochondrial electron transport, cytochrome c to oxygen; and response to oxidative stress. Located in mitochondrial inner membrane. Part of mitochondrial respiratory chain complex IV. Is expressed in several structures, including brown fat; heart; liver; metanephros; and skeletal muscle. Orthologous to human MT-CO1 (mitochondrially encoded cytochrome c oxidase I).