A23094
GLI2 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A23094
- Zusätzliche Namen:
- CJS|GLI2|HPE9|PHS2|THP1|THP2
- Anwendung:
- ELISA, IHC-P, IF, ICC
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PSPGLHGQRRMVAADSNVGPSAPMLGGCQLGFGAPSSLNKNNMPVQWNEVSSGTVDALASQVKPPPFPQGNLAVVQQKPAFGQYPGYSPQGLQASPGGLDS
- Uniprot:
- P10070
- Synonyme:
- CJS;GLI family zinc finger protein 2;GLI-Kruppel family member GLI2;glioma-associated oncogene family zinc finger 2;HPE9;oncogene GLI2;PHS2;Tax helper protein;tax helper protein 1;tax helper protein 2;tax-responsive element-2 holding protein;tax-responsive element-25-bp sequence binding protein;THP1;THP2;zinc finger protein GLI2
- Weitere Details:
- This gene encodes a protein which belongs to the C2H2-type zinc finger protein subclass of the Gli family. Members of this subclass are characterized as transcription factors which bind DNA through zinc finger motifs. These motifs contain conserved H-C links. Gli family zinc finger proteins are mediators of Sonic hedgehog (Shh) signaling and they are implicated as potent oncogenes in the embryonal carcinoma cell. The protein encoded by this gene localizes to the cytoplasm and activates patched Drosophila homolog (PTCH) gene expression. It is also thought to play a role during embryogenesis. The encoded protein is associated with several phenotypes- Greig cephalopolysyndactyly syndrome, Pallister-Hall syndrome, preaxial polydactyly type IV, postaxial polydactyly types A1 and B.
- Versandbedingungen:
- Blue Ice