CD23 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23092
Zusätzliche Namen:: BLAST-2|CD23|CD23A|CLEC4J|FCE2|FCErII|IGEBF
Anwendung:: ELISA, WB
Molekulargewicht:: 47kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Uniprot:: P06734
Synonyme:: BLAST-2;C-type lectin domain family 4 member J;C-type lectin domain family 4, member J;CD23;CD23 antigen;CD23A;CLEC4J;Fc epsilon receptor II;Fc fragment of IgE, low affinity II, receptor for (CD23);fc-epsilon-RII;FCE2;IGEBF;immunoglobulin E-binding factor;immunoglobulin epsilon-chain;low affinity immunoglobulin epsilon Fc receptor;lymphocyte IgE receptor
Weitere Details:: The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Versandbedingungen:: Blue Ice