[KD Validated] ME1 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A23068
Zusätzliche Namen:: [KD Validated] ME1|HUMNDME|MES
Anwendung:: ELISA, WB
Molekulargewicht:: 64kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ
Uniprot:: P48163
Synonyme:: HUMNDME;malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+));Malic enzyme 1;malic enzyme 1, NADP(+)-dependent, cytosolic;malic enzyme 1, soluble;Malic enzyme, cytoplasmic;MES;NADP-dependent malic enzyme;NADP-ME;pyruvic-malic carboxylase
Weitere Details:: This gene encodes a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet.