A23052
CD47 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A23052
- Zusätzliche Namen:
- 9130415E20Rik|B430305P08Rik|CD47|IAP|Itgp
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 45-60kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNT
- Uniprot:
- Q61735
- Synonyme:
- 9130415E20Rik;AA407862;AI848868;antigen identified by monoclonal antibody 1D8;antigenic surface determinant protein OA3;AW108519;B430305P08Rik;CD47 antigen (Rh-related antigen, integrin-associated signal transducer);CD47 glycoprotein;IAP;integrin associated protein;integrin-associated protein;integrin-associated signal transducer;It;Itgp;leukocyte surface antigen CD47;MER6;OA3;Rh-related antigen
- Weitere Details:
- Predicted to enable protein binding activity involved in heterotypic cell-cell adhesion and thrombospondin receptor activity. Involved in regulation of nitric oxide biosynthetic process. Acts upstream of or within several processes, including monocyte aggregation; opsonization; and positive regulation of phagocytosis. Located in extracellular exosome. Is integral component of plasma membrane. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; hemolymphoid system gland; and liver and biliary system. Orthologous to human CD47 (CD47 molecule).
- Versandbedingungen:
- Blue Ice



