CD200 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A23050
Zusätzliche Namen:: CD200|Mox2|OX2
Anwendung:: ELISA, WB
Molekulargewicht:: 45-50kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG
Uniprot:: O54901
Synonyme:: antigen identified by monoclonal antibody MRC OX-2;Mox;Mox2;MRC OX-2 antigen;OX;OX-2 membrane glycoprotein;OX2
Weitere Details:: Predicted to enable protein binding activity involved in heterotypic cell-cell adhesion. Involved in negative regulation of cell population proliferation; negative regulation of macrophage activation; and negative regulation of neuroinflammatory response. Located in cell surface. Is expressed in several structures, including anterior naris; aorta; bone; nervous system; and retina. Used to study autoimmune disease. Orthologous to human CD200 (CD200 molecule).