CD201 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A23049
Zusätzliche Namen:: Ccca|Ccd41|CD201|Epcr
Anwendung:: ELISA, WB
Molekulargewicht:: 45kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGR
Uniprot:: Q64695
Synonyme:: activated protein C receptor;AI325044;APC receptor;Ccc;CCCA;CCD41;CD antigen CD201;CD201 antigen;cell cycle, centrosome-associated protein;centrocyclin;centrosomal protein CCD41;endothelial cell protein C receptor;endothelial protein C receptor;EP;EPCR;protein C receptor, endothelial
Weitere Details:: Predicted to enable protein C-terminus binding activity. Predicted to be involved in negative regulation of coagulation. Predicted to act upstream of or within blood coagulation. Located in centrosome. Is expressed in several structures, including blastocyst; endocardial tissue; female reproductive system; liver; and vascular element. Orthologous to human PROCR (protein C receptor).