A23046
Cleaved Gasdermin B Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A23046
- Zusätzliche Namen:
- Cleaved Gasdermin B|GSDMB-1|GSDML|PP4052|PRO2521
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 16kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PPNRVLSYRVKQLVFPNKETMNIHFRGKTKSFPEGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGELHME
- Uniprot:
- Q8TAX9-6
- Synonyme:
- gasdermin-B;gasdermin-like protein;gasderminB-1;GSDMB-1;GSDML;PP4052;PRO2521
- Weitere Details:
- This gene encodes a member of the gasdermin-domain containing protein family. Other gasdermin-family genes are implicated in the regulation of apoptosis in epithelial cells, and are linked to cancer. Alternative splicing and the use of alternative promoters results in multiple transcript variants. Additional variants have been described, but they are candidates for nonsense-mediated mRNA decay (NMD) and are unlikely to be protein-coding.
- Versandbedingungen:
- Blue Ice