CD81 Rabbit PolymAb[R]

Größe

Auf Anfrage

SKU:: A22986PM
Zusätzliche Namen:: CVID6|S5.7|TAPA1|TSPAN28
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 20kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFS
Uniprot:: P60033
Synonyme:: 26 kDa cell surface protein TAPA-1;CD81 antigen;CD81 antigen (target of antiproliferative antibody 1);CVID6;S5.7;TAPA1;Target of the antiproliferative antibody 1;tetraspanin-28;tspan-28;TSPAN28
Weitere Details:: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice