Activator protein 2 (AP-2/TFAP2A) Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A2294
Zusätzliche Namen:: Activator protein 2 (AP-2/TFAP2A)|AP-2|AP-2alpha|AP2TF|BOFS|TFAP2
Anwendung:: ELISA, WB
Molekulargewicht:: 48kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIH
Uniprot:: P05549
Synonyme:: activating enhancer-binding protein 2-alpha;activator protein 2;AP-2;AP-2 transcription factor;AP-2alpha;AP2TF;BOFS;TFAP2;transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha);transcription factor AP-2-alpha
Weitere Details:: The protein encoded by this gene is a transcription factor that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS). Three transcript variants encoding different isoforms have been found for this gene.