A22868
Bcl9 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A22868
- Zusätzliche Namen:
- Bcl9|LGS
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 149kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- MHSSNPKVRSSPSGNTQSSPKSKQEVMVRPPTVMSPSGNPQLDSKFSNQGKQGGSASQSQPSPCDSKSGGHTPKALPGPGGSMGLKNGAGNGAKGKGKRE
- Uniprot:
- O00512
- Synonyme:
- B cell CLL/lymphoma 9;B-cell CLL/lymphoma 9 protein;B-cell lymphoma 9 protein;bcl-9;LGS;protein legless homolog
- Weitere Details:
- BCL9 is associated with B-cell acute lymphoblastic leukemia. It may be a target of translocation in B-cell malignancies with abnormalities of 1q21. Its function is unknown. The overexpression of BCL9 may be of pathogenic significance in B-cell malignancies.
- Versandbedingungen:
- Blue Ice