[KO Validated] Smad5 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A22749
Zusätzliche Namen:: d5|DWFC|JV5-1|MADH5
Anwendung:: ELISA, WB
Molekulargewicht:: 60 kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDV
Uniprot:: Q99717
Synonyme:: DWFC;JV5-1;MAD, mothers against decapentaplegic homolog 5;MADH5;mothers against decapentaplegic homolog 5;mothers against decapentaplegic, drosophila, homolog of, 5;SMA- and MAD-related protein 5;SMAD family member 5;SMAD, mothers against DPP homolog 5
Weitere Details:: The protein encoded by this gene is involved in the transforming growth factor beta signaling pathway that results in an inhibition of the proliferation of hematopoietic progenitor cells. The encoded protein is activated by bone morphogenetic proteins type 1 receptor kinase, and may be involved in cancer. Alternative splicing results in multiple transcript variants.