SIRT7 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A22735
Zusätzliche Namen:: SIR2L7|SIRT7
Anwendung:: ELISA, WB
Molekulargewicht:: 45 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TPKDDWAALKLHGKCDDVMRLLMAELGLEIPAYSRWQDPIFSLATPLRAGEEGSHSRKSLCRSREEAPPGDRGAPLSSAPILGGWFGRGCTKRTKRKKVT
Uniprot:: Q9NRC8
Synonyme:: NAD-dependent deacetylase sirtuin-7;NAD-dependent protein deacetylase sirtuin-7;NAD-dependent protein deacylase sirtuin-7;regulatory protein SIR2 homolog 7;silent mating type information regulation 2, S.cerevisiae, homolog 7;SIR2-like protein 7;sir2-related protein type 7;SIR2L7;sirtuin type 7
Weitere Details:: This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family.