A22729
FceR1 alpha Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A22729
- Zusätzliche Namen:
- FCE1A|FceR1 alpha|FcERI|FCERIA
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 55-65 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ
- Uniprot:
- P12319
- Synonyme:
- Fc epsilon receptor Ia;Fc epsilon RI alpha-chain;Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide;Fc IgE receptor, alpha polypeptide;Fc-epsilon RI-alpha;FCE1A;FcERI;high affinity immunoglobulin epsilon receptor alpha-subunit;high affinity immunoglobulin epsilon receptor subunit alpha;igE Fc receptor subunit alpha;immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide
- Weitere Details:
- The immunoglobulin epsilon receptor (IgE receptor) is the initiator of the allergic response. When two or more high-affinity IgE receptors are brought together by allergen-bound IgE molecules, mediators such as histamine that are responsible for allergy symptoms are released. This receptor is comprised of an alpha subunit, a beta subunit, and two gamma subunits. The protein encoded by this gene represents the alpha subunit.
- Versandbedingungen:
- Blue Ice