INTS11 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A22698
Zusätzliche Namen:: CPSF3L|CPSF73L|INT11|INTS11|RC-68|RC68
Anwendung:: ELISA, WB
Molekulargewicht:: 68kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKGLPQAPS
Uniprot:: Q5TA45
Synonyme:: cleavage and polyadenylation specific factor 3-like;cleavage and polyadenylation-specific factor 3-like protein;CPSF3-like protein;CPSF3L;CPSF73L;INT11;integrator complex subunit 11;protein related to CPSF subunits of 68 kDa;RC-68;RC68;related to CPSF subunits 68 kDa
Weitere Details:: The Integrator complex contains at least 12 subunits and associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates the 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690). INTS11, or CPSF3L, is the catalytic subunit of the Integrator complex (Baillat et al., 2005 [PubMed 16239144]).