Siglec1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A22677
Zusätzliche Namen:: Cd169|Siglec-1|Siglec1|Sn
Anwendung:: ELISA, WB
Molekulargewicht:: 200kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVSNGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFRFEISDSNRWLDVKGTTVTVTTD
Uniprot:: Q62230
Synonyme:: CD169;SER;sheep erythrocyte receptor;sialic acid binding Ig-like lectin 1, sialoadhesin;sialic acid-binding Ig-like lectin 1;sialic acid-binding immunoglobulin-like lectin 1;sialoadhesin;Sigle;SIGLEC-1;SN
Weitere Details:: Predicted to enable virion binding activity. Acts upstream of or within positive regulation of T cell apoptotic process and positive regulation of extrinsic apoptotic signaling pathway. Predicted to be located in extracellular region and membrane. Predicted to be integral component of membrane. Predicted to be active in early endosome; late endosome; and plasma membrane. Is expressed in immune system; reproductive system; and skin. Orthologous to human SIGLEC1 (sialic acid binding Ig like lectin 1).