A22676
RELA Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A22676
- Zusätzliche Namen:
- p65|p65 NF-kappa B|p65 NFkB|RELA
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 65kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PLAQPPAPAPVLTPGPPQSLSAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAIT
- Uniprot:
- Q04207
- Synonyme:
- avian reticuloendotheliosis viral (v-rel) oncogene homolog A;nuclear factor NF-kappa-B p65 subunit;nuclear factor of kappa light polypeptide gene enhancer in B-cells 3;p6;p65;p65 NF-kappa B;p65 NFkB;transcription factor p65
- Weitere Details:
- Enables several functions, including DNA-binding transcription factor activity, RNA polymerase II-specific; actinin binding activity; and ankyrin repeat binding activity. Involved in several processes, including negative regulation of protein sumoylation; postsynapse to nucleus signaling pathway; and regulation of transcription, DNA-templated. Acts upstream of or within several processes, including cellular response to hepatocyte growth factor stimulus; cellular response to lipopolysaccharide; and positive regulation of interleukin-12 production. Located in several cellular components, including chromatin; cytosol; and glutamatergic synapse. Is expressed in several structures, including alimentary system; early conceptus; genitourinary system; musculature; and skin. Human ortholog(s) of this gene implicated in ductal carcinoma in situ; lung non-small cell carcinoma; lymphoma; and renal cell carcinoma. Orthologous to human RELA (RELA proto-oncogene, NF-kB subunit).
- Versandbedingungen:
- Blue Ice







