MFAP5 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A22675
Zusätzliche Namen:: AAT9|MAGP-2|MAGP2|MFAP-5|MFAP5|MP25
Anwendung:: ELISA, WB
Molekulargewicht:: 25 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
Uniprot:: Q13361
Synonyme:: AAT9;MAGP-2;MAGP2;MFAP-5;Microfibril-associated glycoprotein 2;microfibril-associated glycoprotein-2;microfibrillar associated protein 5;microfibrillar-associated protein 5;MP25;THE1A-MFAP5
Weitere Details:: This gene encodes a 25-kD microfibril-associated glycoprotein which is a component of microfibrils of the extracellular matrix. The encoded protein promotes attachment of cells to microfibrils via alpha-V-beta-3 integrin. Deficiency of this gene in mice results in neutropenia. Alternate splicing results in multiple transcript variants encoding different isoforms.