COL4A6 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A22673
Zusätzliche Namen:: COL4A6|CXDELq22.3|DELXq22.3|DFNX6
Anwendung:: ELISA, WB
Molekulargewicht:: 170-185kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVSRCQVCMKSL
Uniprot:: Q14031
Synonyme:: collagen alpha-6(IV) chain;collagen IV, alpha-6 polypeptide;collagen of basement membrane, alpha-6;collagen, type IV, alpha 6;CXDELq22.3;DELXq22.3;DFNX6;dJ889N15.4 (Collagen Alpha 6(IV))
Weitere Details:: This gene encodes one of the six subunits of type IV collagen, the major structural component of basement membranes. Like the other members of the type IV collagen gene family, this gene is organized in a head-to-head conformation with another type IV collagen gene, alpha 5 type IV collagen, so that the gene pair shares a common promoter. Deletions in the alpha 5 gene that extend into the alpha 6 gene result in diffuse leiomyomatosis accompanying the X-linked Alport syndrome caused by the deletion in the alpha 5 gene. Alternative splicing results in multiple transcript variants encoding different isoforms.