TRPV4 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A22657
Zusätzliche Namen:: BCYM3|CMT2C|HMSN2C|OTRPC4|SMAL|SPSMA|SSQTL1|TRP12|TRPV4|VRL2|VROAC
Anwendung:: ELISA, WB
Molekulargewicht:: 95-102kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TPDRRWCFRVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSNPDEVVVPLDSMGNPRCDGHQQGYPRKWRTDDAPL
Uniprot:: Q9HBA0
Synonyme:: BCYM3;CMT2C;HMSN2C;osm-9-like TRP channel 4;OSM9-like transient receptor potential channel 4;osmosensitive transient receptor potential channel 4;OTRPC4;SMAL;SPSMA;SSQTL1;transient receptor potential cation channel subfamily V member 4;transient receptor potential protein 12;TRP12;vanilloid receptor-like channel 2;Vanilloid receptor-like protein 2;vanilloid receptor-related osmotically activated channel;Vanilloid receptor-related osmotically-activated channel;VRL2;VROAC
Weitere Details:: This gene encodes a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. The encoded protein is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure. Mutations in this gene are the cause of spondylometaphyseal and metatropic dysplasia and hereditary motor and sensory neuropathy type IIC. Multiple transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice