POU4F1Rabbit polyclonal antibody

Größe

£152.00

SKU:: A22620
Zusätzliche Namen:: ATITHS|brn-3A|BRN3A|Oct-T1|RDC-1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAH
Uniprot:: Q01851
Synonyme:: ATITHS;brain-specific homeobox/POU domain protein 3A;brn-3A;BRN3A;homeobox/POU domain protein RDC-1;Oct-T1;POU domain, class 4, transcription factor 1;RDC-1
Weitere Details:: This gene encodes a member of the POU-IV class of neural transcription factors. This protein is expressed in a subset of retinal ganglion cells and may be involved in the developing sensory nervous system. This protein may also promote the growth of cervical tumors. A translocation of this gene is associated with some adult acute myeloid leukemias.