TdT Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A22618
Zusätzliche Namen:: TDT
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 54kDa/58kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIECIRAGKPVEMTGKHQ
Uniprot:: P04053
Synonyme:: DNA nucleotidylexotransferase;nucleosidetriphosphate:DNA deoxynucleotidylexotransferase;TDT;terminal addition enzyme;terminal deoxynucleotidyltransferase;terminal deoxyribonucleotidyltransferase;terminal transferase
Weitere Details:: This gene is a member of the DNA polymerase type-X family and encodes a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, the encoded protein is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor gene segments. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.