A22615
CYP24A1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A22615
- Zusätzliche Namen:
- CP24|CYP24|CYP24A1|HCAI|HCINF1|P450-CC24
- Anwendung:
- ELISA, IHC-P, IF, ICC
- Molekulargewicht:
- Refer to figures
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PQPREVPVCPLTAGGETQNAAALPGPTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIMAIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALP
- Uniprot:
- Q07973
- Synonyme:
- 1,25-@dihydroxyvitamin D3 24-hydroxylase;1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial;24-OHase;CP24;CYP24;cytochrome P450 24A1;cytochrome P450-CC24;cytochrome P450, family 24, subfamily A, polypeptide 1;cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase);exo-mitochondrial protein;HCAI;HCINF1;P450-CC24;vitamin D 24-hydroxylase;vitamin D(3) 24-hydroxylase
- Weitere Details:
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice