A22611
CAMK2A Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A22611
- Zusätzliche Namen:
- CAMK2A|CAMKA|CaMKIIalpha|CaMKIINalpha|MRD53|MRT63
- Anwendung:
- ELISA, WB, IF
- Molekulargewicht:
- 50kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
- Uniprot:
- Q9UQM7
- Synonyme:
- calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha;calcium/calmodulin-dependent protein kinase II alpha-B subunit;calcium/calmodulin-dependent protein kinase type II alpha chain;calcium/calmodulin-dependent protein kinase type II subunit alpha;CaM kinase II alpha subunit;caM kinase II subunit alpha;CaM-kinase II alpha chain;CaMK-II alpha subunit;caMK-II subunit alpha;CAMKA;CaMKIIalpha;CaMKIINalpha;MRD53;MRT63
- Weitere Details:
- The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmodulin-dependent protein kinase is composed of four different chains: alpha, beta, gamma, and delta. The alpha chain encoded by this gene is required for hippocampal long-term potentiation (LTP) and spatial learning. In addition to its calcium-calmodulin (CaM)-dependent activity, this protein can undergo autophosphorylation, resulting in CaM-independent activity. Several transcript variants encoding distinct isoforms have been identified for this gene.
- Versandbedingungen:
- Blue Ice