A22610
BCL6 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A22610
- Zusätzliche Namen:
- BCL5|BCL6|BCL6A|LAZ3|ZBTB27|ZNF51
- Anwendung:
- ELISA, Flow Cytometry
- Molekulargewicht:
- Refer to figures
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASG
- Uniprot:
- P41182
- Synonyme:
- B cell CLL/lymphoma 6;B-cell lymphoma 5 protein;B-cell lymphoma 6 protein;B-cell lymphoma 6 protein transcript;BCL-5;BCL-6;BCL5;BCL6A;cys-his2 zinc finger transcription factor;LAZ3;lymphoma-associated zinc finger gene on chromosome 3;protein LAZ-3;ZBTB27;zinc finger and BTB domain-containing protein 27;zinc finger protein 51;zinc finger transcription factor BCL6S;ZNF51
- Weitere Details:
- The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 responses of B cells. This protein can interact with a variety of POZ-containing proteins that function as transcription corepressors. This gene is found to be frequently translocated and hypermutated in diffuse large-cell lymphoma (DLCL), and may be involved in the pathogenesis of DLCL. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice