A22548
CD85j Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A22548
- Zusätzliche Namen:
- CD85J|ILT-2|ILT2|LIR-1|LIR1|MIR-7|MIR7|PIR-B|PIRB
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 110kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHTGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRH
- Uniprot:
- Q8NHL6
- Synonyme:
- CD85 antigen-like family member J;CD85J;Ig-like transcript 2;ILT-2;ILT2;immunoglobulin heavy chain variable region;Immunoglobulin-like transcript 2;leucocyte Ig-like receptor B1;leukocyte immunoglobulin-like receptor subfamily B member 1;leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1;LIR-1;LIR1;MIR-7;MIR7;monocyte/macrophage immunoglobulin-like receptor 7;myeloid inhibitory receptor 7;PIR-B;PIRB
- Weitere Details:
- This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice



