Tamm Horsfall Glycoprotein Rabbit polyclonal antibody

Größe

£152.00

SKU:: A22544
Zusätzliche Namen:: ADMCKD2|ADTKD1|FJHN|HNFJ|HNFJ1|MCKD2|Tamm Horsfall Glycoprotein|THGP|THP
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 105-120kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LRGWYRFVGQGGARMAETCVPVLRCNTAAPMWLNGTHPSSDEGIVSRKACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGKCQ
Uniprot:: P07911
Synonyme:: ADMCKD2;ADTKD1;FJHN;HNFJ;HNFJ1;MCKD2;Tamm-Horsfall urinary glycoprotein;THGP;THP;uromodulin;uromucoid
Weitere Details:: The protein encoded by this gene is the most abundant protein in mammalian urine under physiological conditions. Its excretion in urine follows proteolytic cleavage of the ectodomain of its glycosyl phosphatidylinosital-anchored counterpart that is situated on the luminal cell surface of the loop of Henle. This protein may act as a constitutive inhibitor of calcium crystallization in renal fluids. Excretion of this protein in urine may provide defense against urinary tract infections caused by uropathogenic bacteria. Defects in this gene are associated with the renal disorders medullary cystic kidney disease-2 (MCKD2), glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI), and familial juvenile hyperuricemic nephropathy (FJHN). Alternative splicing of this gene results in multiple transcript variants.

Versandbedingungen:: Blue Ice