Prolyl hydroxylase PHD1 (EGLN2) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2252
Zusätzliche Namen:: EIT-6|EIT6|HIF-PH1|HIFPH1|HPH-1|HPH-3|PHD1|Prolyl hydroxylase PHD1 (EGLN2)
Anwendung:: ELISA, WB, IP
Molekulargewicht:: 43kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
Uniprot:: Q96KS0
Synonyme:: egl nine homolog 2;EIT-6;EIT6;estrogen-induced tag 6;HIF-PH1;HIF-prolyl hydroxylase 1;HIFPH1;HPH-1;HPH-3;hypoxia-inducible factor prolyl hydroxylase 1;PHD1;prolyl hydroxylase domain-containing protein 1;prolyl hydroxylase EGLN2
Weitere Details:: The hypoxia inducible factor (HIF) is a transcriptional complex that is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this post-translational modification. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream RAB4B (RAB4B, member RAS oncogene family) gene.