PI3 Kinase p85 alpha/beta Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A22487
Zusätzliche Namen:: PI3 Kinase p85 alpha/beta|PIK3R1/PIK3R2
Anwendung:: ELISA, WB
Molekulargewicht:: 85 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQT
Uniprot:: O00459, P27986
Synonyme:: AGM7;GRB1;IMD36;MPPH;MPPH1;p85;p85-ALPHA;p85-BETA;P85B;phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha;phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;phosphatidylinositol 3-kinase regulatory subunit alpha;phosphatidylinositol 3-kinase regulatory subunit beta;phosphatidylinositol 3-kinase-associated p-85 alpha;phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha);phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 2 (p85 beta);phosphoinositide-3-kinase regulatory subunit alpha;phosphoinositide-3-kinase regulatory subunit beta;phosphoinositide-3-kinase, regulatory subunit 1 (alpha);phosphoinositide-3-kinase, regulatory subunit 2 (beta);PI3-kinase subunit p85-alpha;PI3-kinase subunit p85-beta;PI3K regulatory subunit alpha;PI3K regulatory subunit beta;ptdIns-3-kinase regulatory subunit alpha;ptdIns-3-kinase regulatory subunit p85-beta
Weitere Details:: Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory subunit. Phosphatidylinositol 3-kinase plays an important role in the metabolic actions of insulin, and a mutation in this gene has been associated with insulin resistance. Alternative splicing of this gene results in four transcript variants encoding different isoforms. [provided by RefSeq, Jun 2011]

Versandbedingungen:: Blue Ice