A22481PM
Folate Binding Protein(FBP) / FOLR1 Rabbit PolymAb[R]

Größe
Auf Anfrage
- SKU:
- A22481PM
- Zusätzliche Namen:
- FBP|FOLR|FRalpha|NCFTD
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 38kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHF
- Uniprot:
- P15328
- Synonyme:
- adult folate-binding protein;FBP;folate binding protein;Folate receptor 1;folate receptor 1 (adult);folate receptor alpha;folate receptor, adult;FOLR;FR-alpha;FRalpha;KB cells FBP;NCFTD;ovarian tumor-associated antigen MOv18
- Weitere Details:
- The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. Mutations in this gene have been associated with neurodegeneration due to cerebral folate transport deficiency. Due to the presence of two promoters, multiple transcription start sites, and alternative splicing, multiple transcript variants encoding the same protein have been found for this gene.
- Versandbedingungen:
- Blue Ice
![Folate Binding Protein(FBP) / FOLR1 Rabbit PolymAb[R]](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A22481PM/A22481PM_1.jpg)
![Folate Binding Protein(FBP) / FOLR1 Rabbit PolymAb[R]](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A22481PM/A22481PM_2.jpg)
![Folate Binding Protein(FBP) / FOLR1 Rabbit PolymAb[R]](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A22481PM/A22481PM_ARC50859-01_ARC50863-01_WB_01.jpg)
![Folate Binding Protein(FBP) / FOLR1 Rabbit PolymAb[R]](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A22481PM/A22481PM_ARC50859-01_ARC50863-01_WB_02.jpg)