A22473
CD3H Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A22473
- Zusätzliche Namen:
- CD3-ZETA|CD3H|CD3Q|CD3Z|CD3ZETA|IMD25|T3Z|TCRZ
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 18kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- FLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
- Uniprot:
- P20963
- Synonyme:
- CD247 antigen, zeta subunit;CD3-ZETA;CD3H;CD3Q;CD3Z;CD3Z antigen, zeta polypeptide (TiT3 complex);CD3zeta chain;IMD25;T-cell antigen receptor complex, zeta subunit of CD3;T-cell receptor T3 zeta chain;T-cell surface glycoprotein CD3 zeta chain;T3Z;TCR zeta chain;TCRZ
- Weitere Details:
- The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice





