A2247
CBX1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A2247
- Zusätzliche Namen:
- CBX|CBX1|HP1-BETA|HP1Hs-beta|HP1Hsbeta|M31|MOD1|p25beta
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 21kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKP
- Uniprot:
- P83916
- Synonyme:
- CBX;chromobox homolog 1 (HP1 beta homolog Drosophila );chromobox protein homolog 1;heterochromatin protein 1 homolog beta;heterochromatin protein 1-beta;Heterochromatin protein p25;heterochromatin protein p25 beta;HP1 beta homolog;HP1-BETA;HP1Hs-beta;HP1Hsbeta;M31;MOD1;modifier 1 protein;p25beta
- Weitere Details:
- This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The protein may play an important role in the epigenetic control of chromatin structure and gene expression. Several related pseudogenes are located on chromosomes 1, 3, and X. Multiple alternatively spliced variants, encoding the same protein, have been identified.
- Versandbedingungen:
- Blue Ice