CD79B Rabbit PolymAb[R]

Größe

Auf Anfrage

SKU:: A22465PM
Zusätzliche Namen:: AGM6|B29|IGB|Igbeta
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 30-50kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Uniprot:: P40259
Synonyme:: AGM6;B-cell antigen receptor complex-associated protein beta chain;B-cell-specific glycoprotein B29;B29;CD79b antigen (immunoglobulin-associated beta);CD79b molecule, immunoglobulin-associated beta;Ig-beta;IGB;immunoglobulin-associated B29 protein
Weitere Details:: The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.