A22429
SHP2 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A22429
- Zusätzliche Namen:
- BPTP3|CFC|JMML|METCDS|NS1|PTP-1D|PTP2C|SH-PTP2|SH-PTP3|SHP2
- Anwendung:
- ELISA, WB, IP
- Molekulargewicht:
- 70 kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIKYSLADQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR
- Uniprot:
- Q06124
- Synonyme:
- BPTP3;CFC;JMML;METCDS;NS1;protein-tyrosine phosphatase 1D;protein-tyrosine phosphatase 2C;PTP-1D;PTP2C;SH-PTP2;SH-PTP3;SH2 domain-containing protein tyrosine phosphatase 2;SHP2;tyrosine-protein phosphatase non-receptor type 11
- Weitere Details:
- The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.
- Versandbedingungen:
- Blue Ice



