Cation-independent M6PR (IGF2R) Rabbit PolymAb[R]

Größe

Auf Anfrage

SKU:: A22421PM
Zusätzliche Namen:: CD222|CI-M6PR|CIMPR|M6P-R|M6P/IGF2R|MPR 300|MPR1|MPR300|MPRI
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 274kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TNPINGKSFSLGDIYFKLFRASGDMRTNGDNYLYEIQLSSITSSRNPACSGANICQVKPNDQHFSRKVGTSDKTKYYLQDGDLDVVFASSSKCGKDKTKSVSSTIFFHCDPLVEDGIPEFSHETADCQYLFSWYTSAVCPLGVGFDSENPGDDGQMHKGLS
Uniprot:: P11717
Synonyme:: 300 kDa mannose 6-phosphate receptor;cation-independent mannose-6-phosphate receptor;CD222;CI Man-6-P receptor;CI-M6PR;CIMPR;IGF-II receptor;Insulin-like growth factor 2 receptor;insulin-like growth factor II receptor;M6P-R;M6P/IGF2 receptor;M6P/IGF2R;MPR 300;MPR1;MPR300;MPRI
Weitere Details:: This gene encodes a receptor for both insulin-like growth factor 2 and mannose 6-phosphate. The binding sites for each ligand are located on different segments of the protein. This receptor has various functions, including in the intracellular trafficking of lysosomal enzymes, the activation of transforming growth factor beta, and the degradation of insulin-like growth factor 2. Mutation or loss of heterozygosity of this gene has been association with risk of hepatocellular carcinoma. The orthologous mouse gene is imprinted and shows exclusive expression from the maternal allele; however, imprinting of the human gene may be polymorphic, as only a minority of individuals showed biased expression from the maternal allele (PMID:8267611).

Versandbedingungen:: Blue Ice