A22376
JNK1/2/3 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A22376
- Zusätzliche Namen:
- JNK|JNK-46|JNK1|JNK1/JNK3|JNK1A2|JNK21B1/2|JNK3|JNK3A|p493F12|p54bSAPK|PRKM10|PRKM8|SAPK1|SAPK1b|SAPK1c
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 44kDa/54kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
- Uniprot:
- P45983, P45984, P53779
- Synonyme:
- c-Jun kinase 2;c-Jun N-terminal kinase 1;c-Jun N-terminal kinase 2;c-Jun N-terminal kinase 3;JNK;JNK-46;JNK-55;JNK1;JNK1A2;JNK2;JNK21B1/2;JNK2A;JNK2ALPHA;JNK2B;JNK2BETA;JNK3;JNK3 alpha protein kinase;JNK3A;Jun kinase;JUN N-terminal kinase;MAP kinase 10;MAP kinase 8;MAP kinase 9;MAP kinase p49 3F12;MAPK 9;mitogen-activated protein kinase 10;mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;p493F12;p54a;p54aSAPK;p54bSAPK;PRKM10;PRKM8;PRKM9;SAPK;SAPK1;SAPK1a;SAPK1b;SAPK1c;stress activated protein kinase beta;stress-activated protein kinase 1;stress-activated protein kinase 1a;stress-activated protein kinase 1b;stress-activated protein kinase 1c;Stress-activated protein kinase JNK1;stress-activated protein kinase JNK2;stress-activated protein kinase JNK3
- Weitere Details:
- The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various cell stimuli, and targets specific transcription factors, and thus mediates immediate-early gene expression in response to cell stimuli. The activation of this kinase by tumor-necrosis factor alpha (TNF-alpha) is found to be required for TNF-alpha induced apoptosis. This kinase is also involved in UV radiation induced apoptosis, which is thought to be related to cytochrom c-mediated cell death pathway. Studies of the mouse counterpart of this gene suggested that this kinase play a key role in T cell proliferation, apoptosis and differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Apr 2016]
- Versandbedingungen:
- Blue Ice