A22347
CDK1 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A22347
- Zusätzliche Namen:
- CDC2|CDC28A|CDK1|P34CDC2
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 34kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
- Uniprot:
- P06493
- Synonyme:
- CDC2;CDC28A;cell cycle controller CDC2;cell division control protein 2 homolog;cell division cycle 2, G1 to S and G2 to M;cell division protein kinase 1;cyclin-dependent kinase 1;p34 protein kinase;P34CDC2
- Weitere Details:
- The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice








