A22287
LATS1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A22287
- Zusätzliche Namen:
- LATS1|WARTS|wts
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 150kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSE
- Uniprot:
- O95835
- Synonyme:
- h-warts;large tumor suppressor homolog 1;LATS (large tumor suppressor, Drosophila) homolog 1;LATS, large tumor suppressor, homolog 1;serine/threonine-protein kinase LATS1;WARTS;WARTS protein kinase;wts
- Weitere Details:
- The protein encoded by this gene is a putative serine/threonine kinase that localizes to the mitotic apparatus and complexes with cell cycle controller CDC2 kinase in early mitosis. The protein is phosphorylated in a cell-cycle dependent manner, with late prophase phosphorylation remaining through metaphase. The N-terminal region of the protein binds CDC2 to form a complex showing reduced H1 histone kinase activity, indicating a role as a negative regulator of CDC2/cyclin A. In addition, the C-terminal kinase domain binds to its own N-terminal region, suggesting potential negative regulation through interference with complex formation via intramolecular binding. Biochemical and genetic data suggest a role as a tumor suppressor. This is supported by studies in knockout mice showing development of soft-tissue sarcomas, ovarian stromal cell tumors and a high sensitivity to carcinogenic treatments.
- Versandbedingungen:
- Blue Ice