A22286
IL-1RAcP Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A22286
- Zusätzliche Namen:
- C3orf13|IL-1RAcP|IL1R3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 78kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AHFGTDETILDGKEYDIYVSYARNAEEEEFVLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSP
- Uniprot:
- Q9NPH3
- Synonyme:
- C3orf13;IL-1 receptor accessory protein;IL-1RAcP;IL1R3;interleukin-1 receptor 3;interleukin-1 receptor accessory protein;interleukin-1 receptor accessory protein beta
- Weitere Details:
- This gene encodes a component of the interleukin 1 receptor complex, which initiates signalling events that result in the activation of interleukin 1-responsive genes. Alternative splicing of this gene results in membrane-bound and soluble isoforms differing in their C-terminus. The ratio of soluble to membrane-bound forms increases during acute-phase induction or stress.
- Versandbedingungen:
- Blue Ice