IL4 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A22284
Zusätzliche Namen:: BSF-1|Il-4|IL4
Anwendung:: ELISA, WB
Molekulargewicht:: 16kDa/18kDa (Recombinant Protein)
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Uniprot:: P07750
Synonyme:: B cell growth factor 1;B_cell stimulatory factor 1;B-cell growth factor 1;B-cell IgG differentiation factor;B-cell stimulatory factor 1;BCGF-1;BCGF1;binetrakin;BSF-1;BSF1;IGG1 induction factor;Il;IL-4;interleukin 4 variant 2;interleukin-4;lymphocyte stimulatory factor 1;pitrakinra
Weitere Details:: Enables cytokine activity. Involved in several processes, including innate immune response in mucosa; negative regulation of white fat cell proliferation; and regulation of gene expression. Acts upstream of or within several processes, including T-helper cell differentiation; positive regulation of macromolecule metabolic process; and regulation of leukocyte activation. Located in external side of plasma membrane and extracellular space. Is expressed in several structures, including brain; colon; hemolymphoid system; liver; and placenta. Used to study Sjogren's syndrome; atopic dermatitis; and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in several diseases, including asthma (multiple); autoimmune disease (multiple); hepatitis B; hepatitis C; and pancreatic cancer (multiple). Orthologous to human IL4 (interleukin 4).

Versandbedingungen:: Blue Ice