COX6B1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A2228
Zusätzliche Namen:: COX6B|COX6B1|COXG|COXVIb1|MC4DN7
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 10kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
Uniprot:: P14854
Synonyme:: COX VIb-1;COX6B;COXG;COXVIb1;cytochrome c oxidase subunit 6B1;Cytochrome c oxidase subunit VIb isoform 1;cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous);MC4DN7
Weitere Details:: Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively.