A22276
CD58 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A22276
- Zusätzliche Namen:
- ag3|CD58|LFA-3|LFA3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 70 kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
- Uniprot:
- P19256
- Synonyme:
- ag3;CD58 antigen, (lymphocyte function-associated antigen 3);LFA-3;LFA3;lymphocyte function-associated antigen 3;surface glycoprotein LFA-3
- Weitere Details:
- This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes. The protein is localized to the plasma membrane. Alternatively spliced transcript variants have been described.
- Versandbedingungen:
- Blue Ice