A22260
COMP Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A22260
- Zusätzliche Namen:
- COMP|CTS2|EDM1|EPD1|MED|PSACH|THBS5|TSP-5|TSP5
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 100 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFR
- Uniprot:
- P49747
- Synonyme:
- cartilage oligomeric matrix protein;cartilage oligomeric matrix protein (pseudoachondroplasia, epiphyseal dysplasia 1, multiple);CTS2;EDM1;EPD1;MED;PSACH;pseudoachondroplasia (epiphyseal dysplasia 1, multiple);THBS5;thrombospondin-5;TSP5
- Weitere Details:
- The protein encoded by this gene is a noncollagenous extracellular matrix (ECM) protein. It consists of five identical glycoprotein subunits, each with EGF-like and calcium-binding (thrombospondin-like) domains. Oligomerization results from formation of a five-stranded coiled coil and disulfides. Binding to other ECM proteins such as collagen appears to depend on divalent cations. Contraction or expansion of a 5 aa aspartate repeat and other mutations can cause pseudochondroplasia (PSACH) and multiple epiphyseal dysplasia (MED).
- Versandbedingungen:
- Blue Ice

